TLF |
T-LIF |
RADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK |
||
[trypanosome lytic factor 1] TLF-1 is a large (500 kDa) lipid rich high-density lipoprotein present only in the blood of humans and several nonhuman primate species, where it causes resistance to Trypanosoma brucei brucei, which causes disease in livestock and other animals.
TLF1 is composed predominantly of APOA1 [Apolipoprotein A1], haptoglobin-related protein, and APOL1 [apolipoprotein L1] (Lugli et al, 2004; Smith et al, 1995). The APOL1 is component of this complex thought to be responsible for pathogen lysis (Vanhamme et al, 2003), which involves pore formation in lysosomal membranes (Perez-Morga et al, 2005). Thus, TLF1 is a component of the innate immune system
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |