COPE Media Kit


Cope Home
Previous entry:
TLF
Next entry:
T-LIF
Random entry:
RADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Search COPE:

TLF1

[trypanosome lytic factor 1] TLF-1 is a large (500 kDa) lipid rich high-density lipoprotein present only in the blood of humans and several nonhuman primate species, where it causes resistance to Trypanosoma brucei brucei, which causes disease in livestock and other animals.

TLF1 is composed predominantly of APOA1 [Apolipoprotein A1], haptoglobin-related protein, and APOL1 [apolipoprotein L1] (Lugli et al, 2004; Smith et al, 1995). The APOL1 is component of this complex thought to be responsible for pathogen lysis (Vanhamme et al, 2003), which involves pore formation in lysosomal membranes (Perez-Morga et al, 2005). Thus, TLF1 is a component of the innate immune system ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: July 2012



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=49936