rk |
RK-2 |
Epstein Barr virus RTA |
||
[rabbit kidney-1] RK-1 is a peptide (MPCSCKKYCDPWEVIDGSCGLFNSKYICCREK) found in the kidney. It is related to the Corticostatins and Alpha-Defensins and, like some myeloid corticostatin/defensins, inhibits the growth of Escherichia coli. RK-1 can activate epithelial ion channels in vitro (Bateman et al, 1996). In other assay systems for corticostatin-Defensins, such as the inhibition of adrenocorticotropin steroidogenesis stimulated by adrenocorticotropin, or cell lysis, RK-1 is inactive or only weakly active.
McManus et al (2000) have analysed the three-dimensional structure of RK-1 and have classified the protein as a member of the alpha-Defensins.
For other proteins/peptides with functions in
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |