somatostatin and angiotensin-like peptide receptor |
somatostatin I |
DFHKSEIAHRFNDLGEKMFKMLNLDMRNMYLQQKTS |
||
[somatostatin cell]
see: D cells.
For other entries pertaining to hematopoiesis see also the Hematology Dictionary section of this encyclopedia. For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research, Cell culture.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |