SHQDCYEALHKCMASHSKPFSCSMKFHMCLQQQ |
Shrimp anti-lipopolysaccharide factor |
receptor protein tyrosine phosphatase |
||
see: shape-shifted red blood cells.
For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research, Cell culture.
For other entries pertaining to hematopoiesis see also the Hematology Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |