papilloma virus E7 protein |
Papilostatin-1 |
v-fps |
||
This antimicrobial peptide of 34 amino acids (GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ) is produced by hemocytes of the marine invertebrate Halocynthia papillosa. It shows antibacterial activity against Gram-positive bacteria and Gram-negative bacteria. The primary structure does not show any significant similarities with previously described antimicrobial peptides.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |