orexin receptor 2-beta |
orf4 |
GLPQDCERRGGFCSHKSCPPGIGRIGLCSKEDFCCRSRWYS |
||
abbr. also ORX. Orexin A (abbr. OxA) and Orexin B (abbr. OxB) have been identified by Sakurai et al (1998). These two neuropeptide hormones are derived from the same precursor (orexin) by proteolytic processing. The orexin A peptide is QPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLamide, and the orexin B peptide is RSGPPGLQGRLQRLLQASGNHAAGILTMamide. The predicted peptide for orexin A is identical in human, rat, mouse, and bovine. The predicted peptide
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |