monocyte-derived mesenchymal progenitor |
Monocyte-derived neutrophil-activating peptide |
HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS |
||
abbr. MOMCs. These cells are the same as MOMPs [monocyte-derived mesenchymal progenitor], identified previously by Kuwana et al (2003).
These cells constitute a primitive human cell population. The cells have the morphological appearance of fibroblasts and possess a unique phenotype, expressing CD14, CD45, CD34, and collagen type-1. This cell type exhibits mixed morphologic and phenotypic features of monocytes, endothelial cells, and mesenchymal cells.
These cells are derived from circulating CD14(+) monocytes. Their
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |