melanocyte-stimulating hormone release inhibiting factor-1 |
melanoma antigen family D1 |
AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWL |
||
In the nomenclature of CD antigens this protein has been given the designation CD146.
For additional information on CD antigens see also: CD antigens Dictionary.
See remarks in the CD antigens Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |