Ma-type bipolar cells |
Maurocalcine |
a disintegrin and metalloproteinase with thrombospondin motif-10 |
||
This amphipathic anticancer peptide of 48 amino acids (FKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAE), termed also NDBP-2.8 [Non-disulfide-bridged peptide 2.8] (for nomenclature see: Almaaytah and Albalas, 2014), has been found in the venom of the Fat-tailed scorpion Androctonus mauritanicus. The secreted peptide is cytotoxic and potently inhibits the proliferation of prostate cancer cell lines at micromolar concentrations. The peptide shows diminished hemolytic activity against sheep erythrocytes. The peptide appears to kill cancer cells by necrosis rather than
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |