fowlicidin-1(6-26) |
fowlpox virus 016 protein |
hCG-beta(6-40) |
||
fowlicidin-1, (RVKRVWPLVIRTVIAGYNLYRAIKKK),
fowlicidin-2 (LVQRGRFGRFLRKIRRFRPKVTITIQGSARFG), and
fowlicidin-3 (RVKRFWPLVPVAINTVAAGINLYKAIRRK) are very potent antimicrobial peptides that are the counterparts of cathelicidins in chicken. Fowlicidins show potent and salt-independent activities against a range of Gram-negative bacteria and Gram-positive bacteria, including antibiotic-resistant strains. Fowlicidin-1 and fowlicidin-2 also show cytotoxicity for mammalian erythrocytes or epithelial cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |