Echinococcus granulosus tegumental protein |
echinocytic erythrocytes |
CIKNGNGCQPDGSQGNCCSRYCHKEPGWVAGYCR |
||
[echinocyte]
called also: echinocytic erythrocytes. For this shape variant of erythrocytes see: burr cells.
For other entries pertaining to hematopoiesis see also the Hematology Dictionary section of this encyclopedia.
For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research, Cell culture.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |