drosomycin-6 |
Drosophila acid-labile subunit |
formyl peptide receptor-like-1 |
||
abbr. DLD (a term with multiple meanings). Drosomycin-like defensin, CLAGRLDKQCTCRRSQPSRRSGHEVGRPSPHCGPSRQCGCHMD, is a putative human homolog of the Drosophila melanogaster innate immune defense protein drosomycin. Synthetic Drosomycin-like defensin displays a broad spectrum of activity against Aspergillus spp. and other clinically relevant filamentous fungi. These effects are specific for filamentous fungi; no activity is observed against yeasts or Gram-positive or Gram-negative bacteria. Synthetic D
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted !
COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base