centrocin 2 |
centrocytes |
KRHHGYKR |
||
centrocin 1 (GWFKKTFHKVSHAVKSGIHAGQRGCSALGF) and centrocin 2 (SWFSRTVHNVGNAVRKGIHAGQGVCSGLGL) are cationic antimicrobial peptides purified from coelomocyte extracts of the green sea urchin, Strongylocentrotus droebachiensis (Li et al, 2010). Centrocins have an intramolecular heterodimeric structure, containing a heavy chain and a light chain (12 amino acids). The single Cys residue links with another short peptide chain, DLRGACAAAHAL, to form the complete two chain AMP. In addition, the Trp residue is brominated. The heavy chain of Centrocin-2 links with DLRAICAGAHAL, which also has a brominated Trp residue.
The native peptides show potent activities against
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |