cell aggregates |
cell binding protein 2 |
QVRKYCPKVGYCSSKCSKADVWSLSSDCKFYCCLPPGWK |
||
[autonomous cell death] abbr. often CAD (a designation with multiple meanings) This general term pertains to any form of programmed cell death process, in particular to apoptosis, that, when activated in any given cell type, causes the self-destruction of the affected cell (for comparison see also: non-cell-autonomous death, which affects cells in the local environment of the dying cell).
Of interest is a publication by Martins et al (2018) who reported that cancers show heterogeneous responses to treatment with various anticancer agents (ionizing radiation, oxaliplatin, or cisplatin) by individual cancer cells in the population undergoing either cell-autonomous death or participate in
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |