brevinin-1EMa |
brevinin-1Ja |
VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLWYPWTQRF |
||
This antimicrobial peptide belong to the family of Brevinins. The term brevinin-1EMa has been given to gaegurin-6 (see: gaegurins) by Won et al (2009).
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |