amyloid of aging and alzheimer disease |
amyloid P component, serum |
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
||
P-component is a protein found in normal plasma (Cathcart et al, 1967) which is identical with a pentagonal structure found as a minor component of amyloid depositions (fibrils) in organs (Cohen and Calkins, 1959; Bladen et al, 1966). Binette et al (1974) have isolated the human plasma protein and shown that it is identical with a plasma glycoprotein termed 9.5S alpha-1-glycoprotein by Haupt et al (1972). The approved gene symbol for amyloid P component is APCS [serum amyloid P component; amyloid P component, serum]. A commonly used abbreviation is SAP [Serum amyloid P]. The protein is being referred to also as
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |