Alpha-s2-casein |
alpha-s2-casein(25-41) |
ADGF-A2 |
||
This peptide with the sequence KNTMEHVSSSEESIISQETYKQEKNMAINPSK is derived from alpha-s2-casein (approved gene symbol: (gene symbol: CSN1S2; casein-alpha-s2; Alpha-s2-casein) and shows immunomodulatory activities (Hata et al, 1999).
See also cryptides for bioactive fragments of parent proteins. For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |