ABAE cell growth-inhibitory activity |
abalone intestine gastrointestinal digest peptide |
vMCC-1 |
||
abaecin (34 amino acids; YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY) is a major antibacterial response peptide in the honeybee (Apis mellifera) (Casteels et al, 1990). Abaecin has a broad spectrum of antibacterial activities, specific activities against Gram-negative plant pathogens that are lowers than those of other bee peptides (apidaecins), and is incapable of inhibiting bacterial growth at medium ionic strengths. The highest observed specific activity is against an apidaecin-resistant Xanthomonas strain. Expression of the peptide is induced after challenge of honey bees with the natural pathogen Paenibacillus larvae larvae (Evans and Lopez, 2004).
A 39 residue abaecin (FVPYNPPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |