Zinc finger protein Rp-8 |
Zinc finger protein subfamily 1A member 2 |
RSLQDTEEKSRSFSASQADPLSDPDQMNED |
||
[zinc finger protein]
Zinc finger proteins (abbr. Zfp, or zif or znf, followed by a number) are members of a multigene family encoding zinc mediated nucleic acid binding proteins. zinc finger proteins are among the most abundant proteins in eukaryotic genomes and have been isolated from various organisms including yeast, Drosophila melanogaster, Xenopus laevis, mouse and humans. Some of its members have been highly conserved between species (see, for example: Egr-1).
A zinc finger is made up of a short stretch of 28-40 amino acids containing a characteristic C2H2 (Cys-Cys-His-His) motif. Individual
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |