ZBED3-AS1 |
ZBP1-dependent PANoptosomes |
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |
||
[Z-DNA binding protein 1] ZBP1 is the approved gene symbol. The protein contains at least two sequence motifs known to be involved in binding to Z-DNA and one putative B-DNA binding domain, all of which are required for full activation of the immune response (Wang et al, 2008; Kim et al, 2011).
The protein is encoded by C20orf183 [chromosome 20 open reading frame 183] The protein has been identified independently as DLM-1 [Tumor stroma and activated macrophage protein]. DLM-1 expression is highly up-regulated in the peritoneal lining tissue of mice bearing ascites tumors. Mouse peritoneal macrophages, stimulated by IFN-gamma or
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |