zAEVD-fmk |
ZAP |
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY |
||
[Zinc-alpha-2-glycoprotein; Zn-alpha-2-glycoprotein; Zn-alpha-2-GP] abbr. also: ZA2G (Ueyama et al, 1993). The approved gene symbol is AZGP1 [alpha-2-glycoprotein 1, zinc-binding]. This secreted glycoprotein (41 kDa) has been purified from pooled human plasma by Burgi and Schmid (1961), who named it Zinc-alpha-2-glycoprotein. Araki et al (1988) have described the complete amino acid sequence and the carbohydrate structure. The human cDNA has been cloned by Ueyama et al (1991). Ueyama et al (1993) have cloned the genomic DNA.
ZAG is present in plasma
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |