VLPLISMALGKLL |
VLSAADKNNVKGIFTKIAGHAEEYGAETLERMFTTYPPTKTY |
resolution-associated molecular patterns |
||
[Val-Leu-Pro-Val-Pro-Gln-Lys] This peptide, named peptide C by Vij et al (2016) has been obtained from milk fermented with Bifidobacterium bifidum MF 20/5 (Gonzalez-Gonzalez et al, 2013). The peptide is derived by hydrolysis from bovine casein-beta (Chen et al, 2015) and has antioxidative activities (Gonzalez-Gonzalez et al, 2013) and also acts as an inhibitor for ACE [angiotensin-converting enzyme; angiotensin-1 converting enzyme]. This peptide corresponds to casein-beta(170-176) (also: beta-casein(170-176)) (Chen et al, 2015).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted !
COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base