VEGF-189 |
VEGF-205 |
IWDAIFHGAKHFLHRLVNPGGKDAVKDVQQKQ |
||
[Vascular endothelial growth factor-189b] Another designation is VEGF-A189b [Vascular endothelial growth factor A189b]. The terms VEGF(xxx)b and VEGF(xxx) refer to splice isoforms of VEGF (VEGF-A). VEGF-189b is an isoform of VEGF-189 (itself an isoform of VEGF) that lacks sequences from exon 8a (see: VEGF-A for explanation and nomenclature). Unlike VEGF-189, which promotes angiogenesis, VEGF-189b is an anti-angiogenic splice isoform. (Qiu et al, 2009).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |