VEGF-D |
VEGF-E |
LPVNEAQCRQVGGYCGLRICNFPSRFLGLCTRNHPCCSRVWV |
||
This decoy receptor is one of a series of proteins constructed as a soluble protein combining different VEGFR1 and VEGFR2 extracellular domains fused with the Fc region of human immunoglobulin (Yu et al, 2012). FP3 shows high affinity to VEGF-A and VEGF-B. and effectively inhibits human umbilical vein endothelial cell migration and vessel sprouting in a rat aortic ring angiogenesis assay. FP3 inhibits tumor growth in human hepatocellular carcinoma (HepG2), breast cancer (MCF-7
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |