vC4bBP |
VCAM-1 |
CIAKGNGCQPSGVQGNCCSGHCHKEPGWVAGYCK |
||
[very common antigen 2] This antigen has been found to be expressed by a wide range of adherent cells but is absent from cells that grow as suspension cultures (Fradet et al, 1984; Kantor et al, 1987). In databanks VCA-2 is listed as a synonymous designation for integrin-alpha-3.
In the nomenclature of CD antigens this protein has been given the designation CD49c.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |