ulcer-associated cell lineage |
ULK1 |
GGVTGVTEFEPVDVSGEDYDSDEMDEDGRA |
||
This protein belongs to the group of zinc-dependent metalloproteases (metzincins) (Tallant et al, 2006). The proform of ulilysin is a 38 kDa archaeal protein from Methanosarcina acetivorans that shares sequence similarity with PAPP-A but encompasses only the pro-domain and the catalytic domain. The protein undergoes calcium-mediated autolytic activation. Ulilysin has higher proteolytic efficiency and a broader substrate specificity than human PAPP-A. Ulilysin specifically hydrolyzes IGFBP2, IGFBP3, IGFBP4, IGFBP5, IGFBP6, insulin, and extracellular matrix proteins but not IGFBP1 or IGF-2
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |