unc-5 homolog C-like |
UNC40 |
YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT |
||
[uncoordinated locomotion-6] This Caenorhabditis elegans gene has been implicated in guidance of circumferential migrations of pioneer axons and mesodermal cells on the nematode body wall. The protein is secreted from neuroglia and neurons along the ventral midline. In mutants, dorsal and ventral migrations are disrupted, but longitudinal movements are largely unaffected (Wadsworth et al, 2002).
UNC6 encodes a protein (591 amino acids) distantly related to laminin A (Ishii et al, 1992). UNC6 appears to represent the nematode homolog of netrin-1, which guides circumferential migrations on the ectoderm. UNC5
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |