THP-1-derived growth-promoting activity |
THP 3 |
glial cell differentiation regulator |
||
[turkey heterophil peptide 2] This turkey antimicrobial peptide (LFCKRGTCHFGRCPSHLIKVGSCFGFRSCCKWPWDA) (Evans et al, 1994, 1995) belongs to the family of Defensins.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |