Tamm-Horsfall protein |
TAM receptors |
FKIGGFIKKLWRSKLAKKLRAKGRELLKDYANRVINGGPEEEAAVPAE |
||
This peptide corresponds to IL13p [IL13 peptide, interleukin-13 peptide] see: Glioma-homing peptide.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |