Stromelysin-2 |
Strongylocentrotus purpuratus BLIMP1 |
DGGEEQTLSTEAETWVIVALEEGAGPSIQLQLQEVKTGKASQFFGLM |
||
abbr. STMY3. According to a numerical nomenclature this enzyme is now called MMP-11 (matrix metalloproteinase-11). The gene is being referred to as SL-3 or ST-3.
For other entries pertaining to metalloproteinases see also the Metalloproteinase Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |