S phase |
Spheniscin-1 |
CDEs |
||
Spheniscin (also: Spheniscin-1) is an antibiotic peptide (SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW) belonging to the beta-Defensin subfamily isolated from king penguin (Aptenodytes patagonicus) stomach contents (Thouzeau et al, 2003). It exists in two isoforms. Spheniscin increases strongly during the period of food storage. This peptide has a broad activity spectrum, affecting the growth of both pathogenic bacteria and fungi and may play a role, in combination with other antimicrobial peptides, in the long term preservation of stored food in the stomach.
Spheniscin-2 (SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVW) is the most abundant spheniscin. It is a protein of high cationicity that is active at salt
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |