Shv |
sialic acid binding immunoglobulin-like lectin 1 |
GLKDWVKIAGGWLKKKGPGILKAAMAAATQ |
||
(Sanarelli-Shwartzman phenomenon) This phenomenon describes a shock syndrome (see also: Systemic inflammatory response syndrome) initially observed in rabbits receiving repeated injections of bacterial endotoxins. Animals are presensibilised after the first injection of the toxin. A second course leads to local and/or disseminated coagulation, a blocking of peripheral blood vessels by fibrin-rich precipitates, and local inflammation and tissue necrosis in kidney, lung, and heart.
These symptoms resemble those found also in shock and are caused by the release of a variety of inflammatory cytokines induced by endotoxins (see also: acute phase reaction
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |