Scara5 |
scaramanga |
Thymus and Activation Regulated Chemokine |
||
Scarabaecin has been isolated from hemolymph of the coconut rhinoceros beetle Oryctes rhinoceros. This peptide (ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS) has antifungal activity. It is active against phytopathogenic fungi such as Pyricularia oryzae, Rhizoctonia solani, and Botrytis cinerea, but not against phytopathogenic bacteria. It shows weak activity against Bauberia bassiana, an insect pathogenic fungus, and Staphylococcus aureus, a pathogenic bacterium (Tomie et al, 2003). Scarabaecin has been shown to bind to chitin.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |