ST-2 |
ST2V |
MLSLIFLHRLKSMRKRLDRKLRLWHRKNYP |
||
Xu D et al (1998) have identified ST2L as a protein expressed strongly on the cell surface of murine Th2 cells, but not Th1 cells. Cell surface ST2L is co-expressed with intracellular IL4, but not with IFN-gamma. An antibody against a peptide derived from ST2L selectively lyses Th2 cells in vitro in a complement-dependent manner. In vivo, it enhances Th1 cell responses by increasing IFN-gamma production and decreasing IL4 and IL5 synthesis. It induces resistance to Leishmania major infection in BALB/c mice and exacerbates collagen-induced arthritis in DBA/1 mice.
The ligand has been identified as IL33
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |