srt |
SRTHRHSMEIRTPDINPAWYASRGIRPVGRF |
Pepcan-19 |
||
[sheep reproductive tract antimicrobial peptide-40] This antimicrobial peptide, AYVLDEPKPIKDLEKSLQHNLVYCRRLVLEYFLKSIFEYH, has been purified from sheep reproductive tract. The peptide has been shown to possess potent antimicrobial activity against Escherichia coli, Staphylococcus aureus, Streptococcus, Candida albicans (Chen et al, 2015).
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |