SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA |
spIL33 |
S-MZ B-cells |
||
[small protein with inherent killing effect] This evolutionary conserved protein is located in the endoplasmic reticulum. The protein is one of the BH3-only proteins with a single BH3 domain (see: BCL2 homology domains). SPIKE does not seem to interact with various members of the BCL2 family of that counteract cell death by apoptosis. SPIKE has been shown to disrupt interactions between BAP31, which is an adaptor protein for the proform of caspase-8, and another repressor of apoptosis, BCLxL. SPIKE also transmits signals of the death receptor FAS
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |