SMRP |
SMSMLRLamide |
ALWKDVLKKIGTVALHAGKAAFGAAADTISQGGS |
||
This peptide has been identified by phage display library screening (Arap et al, 2002). It is a cell-targeting peptide that homes in to the prostate and prostate vasculature after intravenous injection. Systemic treatment of mice with a chimeric peptide consisting of the SMSIARL homing peptide, linked to the pro-apoptotic peptide KLAKLAK that disrupts mitochondrial membranes, causes tissue destruction in the prostate, but not in other organs. The chimeric peptide delays the development of the cancers in prostate cancer-prone transgenic mice (TRAMP mice).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |