SKW6.4 |
SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
Macrophage inflammatory protein-2-alpha |
||
(SKW6.4) A human B-lymphoblastoid EBV-transformed cell line. It is used, among other things, for detecting B-cell differentiation factors (see: BCDF), BIF (B-cell inducing factor), or TRF (T-cell replacing factors) in bioassays by measuring the induction of the synthesis of immunoglobulins (IgM). SKW6-Cl4 cells do not respond to B-cell growth factors (see: BCGF).
The cells appear to secrete IL1 into the conditioned medium and differentiate into IgM-secreting cells in response to exogenous IL1
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |