SIRP-alpha-3 |
SIRPB2 |
SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW |
||
(approved gene symbol) [signal regulatory protein-beta-1] abbr. also: SIRP-beta-1 [signal regulatory protein-beta-1].
The gene encoding SIRPB1 has been cloned by Kharitonenkov et al (1997). SIRP-beta-1 is a transmembrane protein that has three Ig-like domains in its extracellular region and a short cytoplasmic tail (Kharitonenkov et al, 1997). SIRP-beta-1 is expressed on monocytes and granulocytes but not on lymphocytes (Seiffert et al, 2001).
The ligand of SIRP-beta-1 has not been identified. SIRP-beta-1 has been shown to associate with DAP12 (TYROBP [TYRO protein tyrosine kinase
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |