S7 |
S7 peptide |
GWKDWAKKAGGWLKKKGPGMAKAALKAAMQ |
||
This cell surface antigen is identified by a rat monoclonal antibody of the same name. The 85-95 kDa protein is expressed on granulocytes and all T-cells (thymocytes and peripheral T-cells), but not on most peripheral B-cells (except plasma cells) (Gulley et al, 1988) has been shown to be the murine homolog of human leukosialin (Killeen et al, 1987; Pallant et al, 1989). Hardy et al (1991) have reported that S7 antigen is expressed on early precursors for B-cells and is rapidly lost as these cells progress to pre-B-cell and B-cell stages during in vitro short term culture.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |