S1PR2 |
S1P receptor 1 |
DGGEEQTLSTEAETWEGAGPSIQLQLQEVKGKASQFFGLM |
||
[Sphingosine-1-phosphate receptor 4] also: S1P4 [S1P receptor 4]. The receptor, cloned by Gräler et al (1998) from a dendritic cell library, is known also as EDG6 [Endothelial differentiation G-protein coupled receptor 6]. EDG6 is expressed specifically in fetal and adult lymphoid and hematopoietic tissue as well as in lung. Van Brocklyn et al (2000) have shown that S1PR4 is a high affinity receptor for Sphingosine-1-phosphate, which also binds to S1PR1 and S1PR2.
S1PR4 has been shown to be expressed mostly in a variety of immune cells such as B-cells. dendritic cells,
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |