Rel homology domain |
RELM |
TAMRAVDKLLLHLKKLFREGQFNRNFESIIICRDRT |
||
This Drosophila melanogaster gene (CG11992) encodes fly NF-kappa-B (Dushay et al, 1996), which is one of three NF-kappa-B family members found in Drosophila (the others being Dif [Dorsal-related immunity factor] and Dorsal).
Relish expression is induced strongly in infected flies and it therefore plays a role in immunity. Relish can activate the transcription of various antimicrobial peptides, including Cecropin A1, drosomycin, defensin
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |