Redelberger antigen |
Re-den |
ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS |
||
[Redelberger blood group antigens]
abbr. Rba. This low frequency blood group antigen has been described by Contreras et al (1978). It involves erythrocyte band 3 protein (Bruce and Tanner, 1996).
In the nomenclature of CD antigens the protein has been given the designation CD233.
See also: blood group antigens.
For additional information on CD antigens see also: CD antigens Dictionary.
For other entries pertaining to hematopoiesis see also the Hematology Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |