RVG(175-203) |
RVIEVVQGACRAIRHIPRRIRQGLERIL |
casein-kappa(25-34) |
||
[rabies virus glycoprotein peptide] This peptide, described originally as CVS(175-203) (Rabies virus strain CVS (challenge virus standard)) (Lentz, 1990) is a fragment of rabies virus glycoprotein, corresponding to RVG(175-203) [rabies virus glycoprotein(175-203)] with the sequence YTIWMPENPRPGTPCDIFTNSRGKRASNG. This fragment binds to the alpha-1-subunit of the nicotinic acetylcholine receptor.
Exploiting the specific binding of RVG peptide to the acetylcholine receptor on neuronal cells, RVG peptide has been used as a targeting peptide permitting delivery of cargo proteins to the brain or cells expressing the receptor. The terms RVG-9R and RVG-9dR refer to RVG peptides
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |