RPSA |
RPT-1 |
SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA |
||
[Arg-Pro-Ser-Phe-Ala-Ser-Trp-Glyamide] This peptide corresponds to the invertebrate neuropeptide Perikinin I, a neuropeptide or neurohormone that is related to members of the family of Leucokinins. See: Perikinins.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |