QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY |
QLQGKQVSGEVVQKVLQELIQSVAKP |
chemokine-like factor-6 |
||
This peptide corresponds to TCAP-3 [teneurin C-terminal associated peptide 3]. See: TCAP [teneurin C-terminal associated peptides]
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |