QKKGFCAGYCSYSCAKTDEWTFHQTCGKMYCCIPPPKKG |
qk(v) |
CSF1 receptor |
||
this peptide corresponds to Gloss 2 peptide.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary. For other relevant entries see also the Pathogenicity/Virulence Factors Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |