PV cells |
pVEC |
GRB2 related adapter downstream of shc |
||
[Phaseolus vulgaris defensin-1] This plant defensin (KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC) has been purified from Phaseolus vulgaris seeds (Games et al, 2008). The N-terminal sequence shows high similarity with sequences of different defensins isolated from other plants species (Vigna unguiculata (93%), Cicer arietinum (95%), Pachyrhizus erosus (87%). PvD1 inhibits the growth of the yeasts, Candida albicans, Candida parapsilosis, Candida tropicalis, Candida guilliermondii, Kluyveromyces marxiannus and Saccharomyces cerevisiae. PvD1 is inhibitory also for the growth of phytopathogenic fungi including Fusarium oxysporum, Fusarium solani, Fusarium lateritium and Rizoctonia solani.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |