PARS |
Parstatin(1-26) |
S-prothoracicotropic hormone |
||
This peptide of 41 amino acid (MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR) is an N-terminal fragment obtained by proteolytic cleavage of PAR-1 [protease-activated receptor 1] upon activation by thrombin (Zania et al, 2009). The fragment is being referred to also as TR(1-41) [thrombin receptor (1-41)]. Parstatin is a cell-penetrating peptide and has been shown to be active as an inhibitor of angiogenesis. Huang et al (2010) have reported that Parstatin is a potent anti-angiogenic agent of ocular neovascularization.
In a model of myocardial ischaemia-reperfusion injury Parstatin provides immediate cardioprotection by acting on both the cardiomyocytes
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |