PWTSR |
px |
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
||
[PWWP domains]
This protein domain comprises approximately 80 amino acids (Stec et al, 2000). It is found frequently in proteins associated with chromatin, occurring in proteins of nuclear origin involved in cell growth and differentiation. The domain contains a highly conserved PWWP (Pro-Trp-Trp-Pro) tetrapeptide sequence and is thought to be involved in protein-protein interactions.
Members of a growth factor family related to HDGF [hepatoma-derived growth factor] have been shown to share a highly conserved and ordered N-terminal PWWP domain module (residues 1-100, previously referred to as a HATH domain [homologous to the amino terminus of HDGF
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |